Three polypeptides, the sequences of which are represented below using the one-letter code for their amino acids, are present in a mixture: 1. ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG 2....


Three polypeptides, the sequences of which are represented below using the one-letter code for their amino acids, are present in a mixture:
1. ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG
2. GPYFGDEPLDVHDEPEEG
3. PHLLSAWKGMEGVGKSQSFAALIVILA
Of the three, which one would migrate most slowly during chromatography through:
(a) an ion-exchange resin, beads coated with positively charged groups?
(b) an ion-exchange resin, beads coated with negatively charged groups?
(c) a size-exclusion (gel-filtration) column designed to separate small peptides such as these?
(d) Which peptide contains the ATP-binding motif shown in the following sequence logo?


GK<br>4<br>G<br>2<br>1 2 3 4 5 6 7 8<br>N<br>Bits<br>

Extracted text: GK 4 G 2 1 2 3 4 5 6 7 8 N Bits

Jun 11, 2022
SOLUTION.PDF

Get Answer To This Question

Related Questions & Answers

More Questions »

Submit New Assignment

Copy and Paste Your Assignment Here