Three polypeptides, the sequences of which are represented below using the one-letter code for their amino acids, are present in a mixture:1. ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG2. GPYFGDEPLDVHDEPEEG3. PHLLSAWKGMEGVGKSQSFAALIVILAOf the three, which one would migrate most slowly during chromatography through:(a) an ion-exchange resin, beads coated with positively charged groups?(b) an ion-exchange resin, beads coated with negatively charged groups?(c) a size-exclusion (gel-filtration) column designed to separate small peptides such as these?(d) Which peptide contains the ATP-binding motif shown in the following sequence logo?
Already registered? Login
Not Account? Sign up
Enter your email address to reset your password
Back to Login? Click here